PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016454552.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 438aa    MW: 47988.9 Da    PI: 4.862
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016454552.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.85.7e-14121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W++I+r+    Rt+ q+ s+ qk+
   XP_016454552.1 121 AWTAEEHRLFLQGLEKYGRGDWRSISRHCVVSRTPTQVASHAQKF 165
                      7*****************************9************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512935.4433084IPR017884SANT domain
SMARTSM007170.00433182IPR001005SANT/Myb domain
CDDcd001671.45E-43480No hitNo description
SuperFamilySSF466891.64E-83487IPR009057Homeodomain-like
PROSITE profilePS5129418.979114170IPR017930Myb domain
SuperFamilySSF466891.72E-16116171IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-16118168IPR006447Myb domain, plants
SMARTSM007172.2E-11118168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-11119161IPR009057Homeodomain-like
CDDcd001675.19E-11121166No hitNo description
PfamPF002494.6E-11121164IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MEDEIAFSHY SVLQKISTKG LLFCVAMKTC NSSSWTKEED RAFETALAIY AGDSDQLMKI  60
AAAVPRKSIP EILQHYKKLV DDINDIEAGK VPLPRYGRMQ GCSSRRSRLS GAEVERRKGV  120
AWTAEEHRLF LQGLEKYGRG DWRSISRHCV VSRTPTQVAS HAQKFFSRLK DNNKAKRRRS  180
IHDITTVDTV TTEPSQGQET EKLNGPCGGQ LQWPITDYVT EAFDIGMFPL PRPVTNCMTD  240
AIGGPSSVNP ETFPFGTAVV SELNSSLPNM DDEFLLGVED LITVPTQGTS EAWRGVDTRS  300
STSLSWQPSF VDGTGLYTYP VNSVGYEMEE LITKELVEAT QVGPIVNTAR LPLSIADHIG  360
VHGCTTSSSG AKNGFESTVG ALEAGLSVDS NPLLSIPGTS GSGEYPSFNA SIMDNNIFDL  420
EDLFPDQMIG FYEKDGKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016454552.10.0PREDICTED: uncharacterized protein LOC107778765 isoform X1
TrEMBLA0A0V0J0A01e-139A0A0V0J0A0_SOLCH; Putative ovule protein
TrEMBLM1BM041e-136M1BM04_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000481331e-136(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139501113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-47MYB family protein